PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10003623m
Common NameCARUB_v10003623mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 215aa    MW: 24343 Da    PI: 6.8071
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10003623mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.55.4e-07547344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                      WT  Ed+ + +a  +++ g   +W++Ia  +   +++ ++++++
  Carubv10003623m  5 QWTRSEDKMFEQALVLFPEGspnRWERIADQLH--KSAGEVREHY 47
                     7*******************************7..9********9 PP

2Myb_DNA-binding431.1e-1399143347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+ E++l++ + k++G+g+W++I+r +  +Rt+ q+ s+ qky
  Carubv10003623m  99 PWTENEHKLFLIGLKRYGKGDWRSISRNVVVTRTPTQVASHAQKY 143
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.431155IPR017930Myb domain
SMARTSM007171.6E-7253IPR001005SANT/Myb domain
SuperFamilySSF466899.87E-12458IPR009057Homeodomain-like
PfamPF002491.4E-5548IPR001005SANT/Myb domain
CDDcd001673.27E-6651No hitNo description
PROSITE profilePS5129418.26192148IPR017930Myb domain
SuperFamilySSF466892.44E-1694149IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-1695147IPR006447Myb domain, plants
SMARTSM007177.0E-996146IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-1098142IPR009057Homeodomain-like
PfamPF002491.7E-1199143IPR001005SANT/Myb domain
CDDcd001674.80E-899144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MASSQWTRSE DKMFEQALVL FPEGSPNRWE RIADQLHKSA GEVREHYEAL VHDVFEIDAG  60
RVDVPDYMDD SAAAAGWDSA GQISFGSKHG ESERKRGTPW TENEHKLFLI GLKRYGKGDW  120
RSISRNVVVT RTPTQVASHA QKYFLRQNSV KKERKRSSIH DITTVDTNLA MPGSNMDWTG  180
QHGSPVQPPQ QQQLLSEFGQ QLNPGHFEDF GFRM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0509760.0AY050976.1 Arabidopsis thaliana putative I-box binding factor (At5g04760) mRNA, complete cds.
GenBankAY0883620.0AY088362.1 Arabidopsis thaliana clone 6170 mRNA, complete sequence.
GenBankAY0911770.0AY091177.1 Arabidopsis thaliana putative I-box binding factor (At5g04760) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006289993.11e-160hypothetical protein CARUB_v10003623mg
SwissprotQ8S9H71e-58DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLR0FLN31e-160R0FLN3_9BRAS; Uncharacterized protein
STRINGscaffold_600421.11e-147(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM51272750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.11e-132MYB family protein